Lineage for d6qnad2 (6qna D:110-213)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754143Species Cow (Bos taurus) [TaxId:9913] [226022] (18 PDB entries)
  8. 2754204Domain d6qnad2: 6qna D:110-213 [369447]
    Other proteins in same PDB: d6qnaa2, d6qnaa3, d6qnac2, d6qnae2, d6qnah2, d6qnah3
    automated match to d4k3dl2
    complexed with gol

Details for d6qnad2

PDB Entry: 6qna (more details), 2.62 Å

PDB Description: structure of bovine anti-rsv hybrid fab b13hc-b4lc
PDB Compounds: (D:) B4 light chain

SCOPe Domain Sequences for d6qnad2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6qnad2 b.1.1.0 (D:110-213) automated matches {Cow (Bos taurus) [TaxId: 9913]}
qpksppsvtlfppsteelngnkatlvclisdfypgsvtvvwkadgstitrnvettraskq
snskyaassylsltssdwkskgsyscevthegstvtktvkpsec

SCOPe Domain Coordinates for d6qnad2:

Click to download the PDB-style file with coordinates for d6qnad2.
(The format of our PDB-style files is described here.)

Timeline for d6qnad2: