SCOPe 2.07: Domain d6q2wb_: 6q2w B:

Lineage for d6q2wb_ (6q2w B:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
   multihelical; 3 layers or orthogonally packed helices

4. Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families)

5. Family a.123.1.0: automated matches [191623] (1 protein)
   not a true family

6. Protein automated matches [191142] (6 species)
   not a true protein

7. Species Nomascus leucogenys [TaxId:61853] [335245] (17 PDB entries)

8. Domain d6q2wb_: 6q2w B: [369441]
   automated match to d5x8sb_
   complexed with hbw

Details for d6q2wb_

PDB Entry: 6q2w, 1.99 Å

PDB Description: crystal structure of human ror gamma lbd in complex with a quinoline sulfonamide inverse agonist

PDB Compounds: (B:) Nuclear receptor ROR-gamma

SCOPe Domain Sequences for d6q2wb_:

Sequence; same for both SEQRES and ATOM records:

>d6q2wb_ a.123.1.0 (B:) automated matches {Nomascus leucogenys [TaxId: 61853]}
lteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercahhlte
aiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegkyggme
lfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveqlqynl
elafhhhlckthrqsilaklppkgklrslcsqhverlqif

Timeline for d6q2wb_:

• d6q2wb_ is new in SCOPe 2.07-stable
  
• d6q2wb_ appears in the current release, SCOPe 2.08