Lineage for d5zlca3 (5zlc A:290-494)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2563564Fold d.218: Nucleotidyltransferase [81302] (1 superfamily)
    core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123
  4. 2563565Superfamily d.218.1: Nucleotidyltransferase [81301] (16 families) (S)
  5. 2564030Family d.218.1.0: automated matches [227287] (1 protein)
    not a true family
  6. 2564031Protein automated matches [227105] (5 species)
    not a true protein
  7. 2564035Species Human (Homo sapiens) [TaxId:9606] [226559] (17 PDB entries)
  8. 3069370Domain d5zlca3: 5zlc A:290-494 [369432]
    Other proteins in same PDB: d5zlca1, d5zlca2
    automated match to d4lzda3
    protein/DNA complex; complexed with dgt, mn, so4

Details for d5zlca3

PDB Entry: 5zlc (more details), 2 Å

PDB Description: binary complex of human dna polymerase mu with mndgtp
PDB Compounds: (A:) DNA-directed DNA/RNA polymerase mu

SCOPe Domain Sequences for d5zlca3:

Sequence, based on SEQRES records: (download)

>d5zlca3 d.218.1.0 (A:290-494) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vlrsdvdalqqvveeavgqalpgatvtltggfrrgklqghdvdflithpkegqeagllpr
vmcrlqdqglilyhqhqhsccesptrlaqqshmdafersfcifrlpqpgswkavrvdlvv
apvsqfpfallgwtgsklfqrelrrfsrkekglwlnshglfdpeqktffqaaseedifrh
lgleylppeqrna

Sequence, based on observed residues (ATOM records): (download)

>d5zlca3 d.218.1.0 (A:290-494) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vlrsdvdalqqvveeavgqalpgatvtltggfrrgklqghdvdflithpkegqeagllpr
vmcrlqdqglilyhqhqhsccafersfcifrlpqpgswkavrvdlvvapvsqfpfallgw
tgsklfqrelrrfsrkekglwlnshglfdpeqktffqaaseedifrhlgleylppeqrna

SCOPe Domain Coordinates for d5zlca3:

Click to download the PDB-style file with coordinates for d5zlca3.
(The format of our PDB-style files is described here.)

Timeline for d5zlca3:

  • d5zlca3 is new in SCOPe 2.07-stable