Lineage for d176lb_ (176l B:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 714012Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 714013Superfamily d.2.1: Lysozyme-like [53955] (7 families) (S)
  5. 714660Family d.2.1.3: Phage lysozyme [53981] (3 proteins)
  6. 714666Protein Phage T4 lysozyme [53982] (1 species)
  7. 714667Species Bacteriophage T4 [TaxId:10665] [53983] (431 PDB entries)
    many mutant structures
  8. 715079Domain d176lb_: 176l B: [36943]
    complexed with cl; mutant

Details for d176lb_

PDB Entry: 176l (more details), 2.2 Å

PDB Description: protein flexibility and adaptability seen in 25 crystal forms of t4 lysozyme
PDB Compounds: (B:) t4 lysozyme

SCOP Domain Sequences for d176lb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d176lb_ d.2.1.3 (B:) Phage T4 lysozyme {Bacteriophage T4 [TaxId: 10665]}
mnifemlrideglrlkiykdtegyytigightlkvdgnsnaakseldkaigrntngvitk
deaeklfnqdvdaavrgilrnaklkpvydsldavrraalinmvfqmgetgvagftnslrm
lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayknl

SCOP Domain Coordinates for d176lb_:

Click to download the PDB-style file with coordinates for d176lb_.
(The format of our PDB-style files is described here.)

Timeline for d176lb_: