Lineage for d176lb_ (176l B:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 28759Fold d.2: Lysozyme-like [53954] (1 superfamily)
  4. 28760Superfamily d.2.1: Lysozyme-like [53955] (7 families) (S)
  5. 29167Family d.2.1.3: Phage T4 lysozyme [53981] (1 protein)
  6. 29168Protein Phage T4 lysozyme [53982] (1 species)
  7. 29169Species Bacteriophage T4 [TaxId:10665] [53983] (336 PDB entries)
  8. 29492Domain d176lb_: 176l B: [36943]

Details for d176lb_

PDB Entry: 176l (more details), 2.2 Å

PDB Description: protein flexibility and adaptability seen in 25 crystal forms of t4 lysozyme

SCOP Domain Sequences for d176lb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d176lb_ d.2.1.3 (B:) Phage T4 lysozyme {Bacteriophage T4}
mnifemlrideglrlkiykdtegyytigightlkvdgnsnaakseldkaigrntngvitk
deaeklfnqdvdaavrgilrnaklkpvydsldavrraalinmvfqmgetgvagftnslrm
lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayknl

SCOP Domain Coordinates for d176lb_:

Click to download the PDB-style file with coordinates for d176lb_.
(The format of our PDB-style files is described here.)

Timeline for d176lb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d176la_