Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (319 species) not a true protein |
Species Escherichia coli [TaxId:83333] [349042] (4 PDB entries) |
Domain d6oz7c_: 6oz7 C: [369420] automated match to d5epoa_ complexed with ca, edo, pge |
PDB Entry: 6oz7 (more details), 1.36 Å
SCOPe Domain Sequences for d6oz7c_:
Sequence, based on SEQRES records: (download)
>d6oz7c_ c.2.1.0 (C:) automated matches {Escherichia coli [TaxId: 83333]} aqvaiitasdsgigkecalllaqqgfdigitwhsdeegakdtarevvshgvraeivqldl gnlpegalalekliqrlgridvlvnnagamtkapfldmafdewrkiftvdvdgaflcsqi aarqmvkqgqggriinitsvhehtplpdasaytaakhalggltkamalelvrhkilvnav apgaiatpmngmddsdvkpdaepsiplrrfgatheiaslvvwlcseganyttgqslivdg gfmlanpqfnp
>d6oz7c_ c.2.1.0 (C:) automated matches {Escherichia coli [TaxId: 83333]} aqvaiitasdsgigkecalllaqqgfdigitwhsdeegakdtarevvshgvraeivqldl gnlpegalalekliqrlgridvlvnnagamtkapfldmafdewrkiftvdvdgaflcsqi aarqmvkqgqggriinitsvhehtplpdasaytaakhalggltkamalelvrhkilvnav apgaiatkpdaepsiplrrfgatheiaslvvwlcseganyttgqslivdggfmlanpqfn p
Timeline for d6oz7c_: