Lineage for d176la_ (176l A:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 76064Fold d.2: Lysozyme-like [53954] (1 superfamily)
  4. 76065Superfamily d.2.1: Lysozyme-like [53955] (7 families) (S)
  5. 76503Family d.2.1.3: Phage T4 lysozyme [53981] (1 protein)
  6. 76504Protein Phage T4 lysozyme [53982] (1 species)
  7. 76505Species Bacteriophage T4 [TaxId:10665] [53983] (348 PDB entries)
  8. 76838Domain d176la_: 176l A: [36942]

Details for d176la_

PDB Entry: 176l (more details), 2.2 Å

PDB Description: protein flexibility and adaptability seen in 25 crystal forms of t4 lysozyme

SCOP Domain Sequences for d176la_:

Sequence; same for both SEQRES and ATOM records: (download)

>d176la_ d.2.1.3 (A:) Phage T4 lysozyme {Bacteriophage T4}
mnifemlrideglrlkiykdtegyytigightlkvdgnsnaakseldkaigrntngvitk
deaeklfnqdvdaavrgilrnaklkpvydsldavrraalinmvfqmgetgvagftnslrm
lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayknl

SCOP Domain Coordinates for d176la_:

Click to download the PDB-style file with coordinates for d176la_.
(The format of our PDB-style files is described here.)

Timeline for d176la_:

View in 3D
Domains from other chains:
(mouse over for more information)
d176lb_