Lineage for d6nxza_ (6nxz A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2783741Superfamily b.34.4: Electron transport accessory proteins [50090] (5 families) (S)
  5. 2783742Family b.34.4.1: R67 dihydrofolate reductase [50091] (2 proteins)
  6. 2783747Protein automated matches [190309] (1 species)
    not a true protein
  7. 2783748Species Escherichia coli [TaxId:562] [187228] (8 PDB entries)
  8. 2783756Domain d6nxza_: 6nxz A: [369418]
    automated match to d1viea_
    complexed with d49, mrd, po4

Details for d6nxza_

PDB Entry: 6nxz (more details), 1.75 Å

PDB Description: crystal structure of trimethoprim-resistant type ii dihydrofolate reductase in complex with a bisbenzimidazole inhibitor
PDB Compounds: (A:) Dihydrofolate reductase type 2

SCOPe Domain Sequences for d6nxza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6nxza_ b.34.4.1 (A:) automated matches {Escherichia coli [TaxId: 562]}
atfgmgdrvrkksgaawqgqivgwyctnltpegyaveseahpgsvqiypvaaleri

SCOPe Domain Coordinates for d6nxza_:

Click to download the PDB-style file with coordinates for d6nxza_.
(The format of our PDB-style files is described here.)

Timeline for d6nxza_: