Lineage for d6ipja1 (6ipj A:137-230)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2328564Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2329042Superfamily a.60.6: DNA polymerase beta, N-terminal domain-like [47802] (2 families) (S)
    contains one classic and one pseudo HhH motifs
  5. 2329269Family a.60.6.0: automated matches [254214] (1 protein)
    not a true family
  6. 2329270Protein automated matches [254482] (3 species)
    not a true protein
  7. 2329271Species Human (Homo sapiens) [TaxId:9606] [255046] (17 PDB entries)
  8. 2329286Domain d6ipja1: 6ipj A:137-230 [369395]
    Other proteins in same PDB: d6ipja2, d6ipja3
    automated match to d4lzda1
    protein/DNA complex; complexed with mn, so4, ttp

Details for d6ipja1

PDB Entry: 6ipj (more details), 1.98 Å

PDB Description: binary complex of human dna polymerase mu with mndttp
PDB Compounds: (A:) DNA-directed DNA/RNA polymerase mu,DNA-directed DNA/RNA polymerase mu

SCOPe Domain Sequences for d6ipja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ipja1 a.60.6.0 (A:137-230) automated matches {Human (Homo sapiens) [TaxId: 9606]}
wmpayacqrptplthhntglsealeilaeaagfegsegrlltfcraasvlkalpspvttl
sqlqglphfgehssrvvqellehgvceevervrr

SCOPe Domain Coordinates for d6ipja1:

Click to download the PDB-style file with coordinates for d6ipja1.
(The format of our PDB-style files is described here.)

Timeline for d6ipja1: