Lineage for d6o2xa_ (6o2x A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2926589Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2926590Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2926591Family d.3.1.1: Papain-like [54002] (26 proteins)
  6. 2926815Protein Cruzain [54020] (1 species)
  7. 2926816Species Trypanosoma cruzi [TaxId:5693] [54021] (29 PDB entries)
  8. 2926823Domain d6o2xa_: 6o2x A: [369391]
    automated match to d1f2aa_
    complexed with edo, po4

Details for d6o2xa_

PDB Entry: 6o2x (more details), 1.19 Å

PDB Description: structure of cruzain bound to mmts inhibitor
PDB Compounds: (A:) Cruzipain

SCOPe Domain Sequences for d6o2xa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6o2xa_ d.3.1.1 (A:) Cruzain {Trypanosoma cruzi [TaxId: 5693]}
apaavdwrargavtavkdqgqcgscwafsaignvecqwflaghpltnlseqmlvscdktd
sgcsgglmnnafewivqenngavytedsypyasgegisppcttsghtvgatitghvelpq
deaqiaawlavngpvavavdasswmtytggvmtscvseqldhgvllvgyndsaavpywii
knswttqwgeegyiriakgsnqclvkeeassavvg

SCOPe Domain Coordinates for d6o2xa_:

Click to download the PDB-style file with coordinates for d6o2xa_.
(The format of our PDB-style files is described here.)

Timeline for d6o2xa_: