SCOPe 2.08: Domain d6dj6a_: 6dj6 A:

Lineage for d6dj6a_ (6dj6 A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.119: DAK1/DegV-like [82548] (1 superfamily)
   2 different domains; d1: [core: 3 layers, a/b/a; parallel sheet of 5 strands, order: 2134]; D2: [2 layers, a/b; mixed sheet of 6 strands, order 321645; strands 2 and 6 are antiparallel to the rest]

4. Superfamily c.119.1: DAK1/DegV-like [82549] (3 families)
   domain folds and architecture show some similarity to the tubulin-like GTPases; the nucleotide-binding sites of the Dihydroxyacetone kinase and tubulin families are different

5. Family c.119.1.0: automated matches [191443] (1 protein)
   not a true family

6. Protein automated matches [190655] (13 species)
   not a true protein

7. Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [369306] (4 PDB entries)

8. Domain d6dj6a_: 6dj6 A: [369390]
   automated match to d4x9xa_
   complexed with gol, na, ola

Details for d6dj6a_

PDB Entry: 6dj6, 1.9 Å

PDB Description: the x-ray crystal structure of the streptococcus pneumoniae fatty acid kinase (fak) b2 protein loaded with cis-oleic acid to 1.9 angstrom resolution

PDB Compounds: (A:) Fatty Acid Kinase (Fak) B2 protein (SPR1019)

SCOPe Domain Sequences for d6dj6a_:

Sequence; same for both SEQRES and ATOM records:

>d6dj6a_ c.119.1.0 (A:) automated matches {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
mtkikivtdssvtiepelvkqlditivplsvmidnvvysdadlkeegkflqlmqesknlp
ktsqppvgvfaeifedlckdggqilaihmshalsgtveaarqgaslstadvivvdssftd
qalkfqvveaaklaqegkdmeailshveevknhtelyigvstlenlvkggrigrvtglls
sllnirvvmqmkdhelqpmvkgrgtktfkkwldelitslseravaeigisysgsddwake
mkeslqayvekpisvletgsiiqthtgenawailiryh

Timeline for d6dj6a_:

• d6dj6a_ first appeared in SCOPe 2.07