Lineage for d6dj6a_ (6dj6 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2921751Fold c.119: DAK1/DegV-like [82548] (1 superfamily)
    2 different domains; d1: [core: 3 layers, a/b/a; parallel sheet of 5 strands, order: 2134]; D2: [2 layers, a/b; mixed sheet of 6 strands, order 321645; strands 2 and 6 are antiparallel to the rest]
  4. 2921752Superfamily c.119.1: DAK1/DegV-like [82549] (3 families) (S)
    domain folds and architecture show some similarity to the tubulin-like GTPases; the nucleotide-binding sites of the Dihydroxyacetone kinase and tubulin families are different
  5. 2921799Family c.119.1.0: automated matches [191443] (1 protein)
    not a true family
  6. 2921800Protein automated matches [190655] (13 species)
    not a true protein
  7. 2921817Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [369306] (4 PDB entries)
  8. 2921820Domain d6dj6a_: 6dj6 A: [369390]
    automated match to d4x9xa_
    complexed with gol, na, ola

Details for d6dj6a_

PDB Entry: 6dj6 (more details), 1.9 Å

PDB Description: the x-ray crystal structure of the streptococcus pneumoniae fatty acid kinase (fak) b2 protein loaded with cis-oleic acid to 1.9 angstrom resolution
PDB Compounds: (A:) Fatty Acid Kinase (Fak) B2 protein (SPR1019)

SCOPe Domain Sequences for d6dj6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6dj6a_ c.119.1.0 (A:) automated matches {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
mtkikivtdssvtiepelvkqlditivplsvmidnvvysdadlkeegkflqlmqesknlp
ktsqppvgvfaeifedlckdggqilaihmshalsgtveaarqgaslstadvivvdssftd
qalkfqvveaaklaqegkdmeailshveevknhtelyigvstlenlvkggrigrvtglls
sllnirvvmqmkdhelqpmvkgrgtktfkkwldelitslseravaeigisysgsddwake
mkeslqayvekpisvletgsiiqthtgenawailiryh

SCOPe Domain Coordinates for d6dj6a_:

Click to download the PDB-style file with coordinates for d6dj6a_.
(The format of our PDB-style files is described here.)

Timeline for d6dj6a_: