Lineage for d6diha1 (6dih A:162-350)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2977836Fold d.136: Phospholipase D/nuclease [56023] (1 superfamily)
    beta-alpha-beta-alpha-beta-alpha-beta(4)-alpha; mixed sheet: order 1765234
  4. 2977837Superfamily d.136.1: Phospholipase D/nuclease [56024] (6 families) (S)
  5. 2977862Family d.136.1.3: Tyrosyl-DNA phosphodiesterase TDP1 [69815] (2 proteins)
  6. 2977863Protein Tyrosyl-DNA phosphodiesterase TDP1 [69816] (2 species)
  7. 2977873Species Human (Homo sapiens) [TaxId:9606] [69817] (36 PDB entries)
  8. 2977968Domain d6diha1: 6dih A:162-350 [369387]
    automated match to d1qzqa1
    complexed with edo, gjs

Details for d6diha1

PDB Entry: 6dih (more details), 1.78 Å

PDB Description: crystal structure of tdp1 catalytic domain in complex with sigma aldrich compound ph004941
PDB Compounds: (A:) tyrosyl-DNA phosphodiesterase 1

SCOPe Domain Sequences for d6diha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6diha1 d.136.1.3 (A:162-350) Tyrosyl-DNA phosphodiesterase TDP1 {Human (Homo sapiens) [TaxId: 9606]}
npfqfyltrvsgvkpkynsgalhikdilsplfgtlvssaqfnycfdvdwlvkqyppefrk
kpillvhgdkreakahlhaqakpyenislcqakldiafgthhtkmmlllyeeglrvviht
snlihadwhqktqgiwlsplypriadgthksgespthfkadlisylmaynapslkewidv
ihkhdlset

SCOPe Domain Coordinates for d6diha1:

Click to download the PDB-style file with coordinates for d6diha1.
(The format of our PDB-style files is described here.)

Timeline for d6diha1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6diha2