Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.136: Phospholipase D/nuclease [56023] (1 superfamily) beta-alpha-beta-alpha-beta-alpha-beta(4)-alpha; mixed sheet: order 1765234 |
Superfamily d.136.1: Phospholipase D/nuclease [56024] (6 families) |
Family d.136.1.3: Tyrosyl-DNA phosphodiesterase TDP1 [69815] (2 proteins) |
Protein Tyrosyl-DNA phosphodiesterase TDP1 [69816] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [69817] (36 PDB entries) |
Domain d6diha1: 6dih A:162-350 [369387] automated match to d1qzqa1 complexed with edo, gjs |
PDB Entry: 6dih (more details), 1.78 Å
SCOPe Domain Sequences for d6diha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6diha1 d.136.1.3 (A:162-350) Tyrosyl-DNA phosphodiesterase TDP1 {Human (Homo sapiens) [TaxId: 9606]} npfqfyltrvsgvkpkynsgalhikdilsplfgtlvssaqfnycfdvdwlvkqyppefrk kpillvhgdkreakahlhaqakpyenislcqakldiafgthhtkmmlllyeeglrvviht snlihadwhqktqgiwlsplypriadgthksgespthfkadlisylmaynapslkewidv ihkhdlset
Timeline for d6diha1: