![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.60: SAM domain-like [47768] (17 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
![]() | Superfamily a.60.12: PsbU/PolX domain-like [81585] (3 families) ![]() contains one classic and one pseudo HhH motifs |
![]() | Family a.60.12.0: automated matches [254215] (1 protein) not a true family |
![]() | Protein automated matches [254483] (3 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [255047] (17 PDB entries) |
![]() | Domain d6ipma2: 6ipm A:231-289 [369385] Other proteins in same PDB: d6ipma1, d6ipma3 automated match to d4lzda2 protein/DNA complex; complexed with dcp, mg, so4 |
PDB Entry: 6ipm (more details), 1.72 Å
SCOPe Domain Sequences for d6ipma2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6ipma2 a.60.12.0 (A:231-289) automated matches {Human (Homo sapiens) [TaxId: 9606]} seryqtmklftqifgvgvktadrwyreglrtlddlreqpqkltqqqkaglqhhqdlstp
Timeline for d6ipma2: