Lineage for d167lb_ (167l B:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1887016Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 1887017Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 1888126Family d.2.1.3: Phage lysozyme [53981] (4 proteins)
  6. 1888132Protein Phage T4 lysozyme [53982] (1 species)
  7. 1888133Species Bacteriophage T4 [TaxId:10665] [53983] (546 PDB entries)
    Uniprot P00720
    many mutant structures
  8. 1888666Domain d167lb_: 167l B: [36938]

Details for d167lb_

PDB Entry: 167l (more details), 2.2 Å

PDB Description: protein flexibility and adaptability seen in 25 crystal forms of t4 lysozyme
PDB Compounds: (B:) t4 lysozyme

SCOPe Domain Sequences for d167lb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d167lb_ d.2.1.3 (B:) Phage T4 lysozyme {Bacteriophage T4 [TaxId: 10665]}
mncfemlrcdeglrlkiykdtegyytigighlltkspslnaakseldkaigrntngvitk
deaeklfnqdvdaavrgilrnaklkpvydsldavrrcalinmvfqmgetgvagftnslrm
lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayknc

SCOPe Domain Coordinates for d167lb_:

Click to download the PDB-style file with coordinates for d167lb_.
(The format of our PDB-style files is described here.)

Timeline for d167lb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d167la_