SCOP 1.71: Domain d167lb_: 167l B:

Lineage for d167lb_ (167l B:)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (7 families)

5. Family d.2.1.3: Phage lysozyme [53981] (3 proteins)

6. Protein Phage T4 lysozyme [53982] (1 species)

7. Species Bacteriophage T4 [TaxId:10665] [53983] (405 PDB entries)
   many mutant structures

8. Domain d167lb_: 167l B: [36938]
   mutant

Details for d167lb_

PDB Entry: 167l, 2.2 Å

PDB Description: protein flexibility and adaptability seen in 25 crystal forms of t4 lysozyme

SCOP Domain Sequences for d167lb_:

Sequence; same for both SEQRES and ATOM records:

>d167lb_ d.2.1.3 (B:) Phage T4 lysozyme {Bacteriophage T4}
mncfemlrcdeglrlkiykdtegyytigighlltkspslnaakseldkaigrntngvitk
deaeklfnqdvdaavrgilrnaklkpvydsldavrrcalinmvfqmgetgvagftnslrm
lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayknc

Timeline for d167lb_:

• d167lb_ first appeared (with stable ids) in SCOP 1.55
  
• d167lb_ appears in SCOP 1.69
  
• d167lb_ appears in SCOP 1.73
  
• d167lb_ appears in the current release, SCOPe 2.08