Lineage for d6nurb_ (6nur B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3010369Fold d.302: Coronavirus NSP8-like [143075] (1 superfamily)
    core: alpha-beta(2)-alpha-beta(4)-alpha-beta; bifurcated barrel-like beta-sheet
  4. 3010370Superfamily d.302.1: Coronavirus NSP8-like [143076] (1 family) (S)
    automatically mapped to Pfam PF08717
  5. 3010371Family d.302.1.1: Coronavirus NSP8-like [143077] (2 proteins)
  6. 3010378Protein automated matches [369375] (3 species)
    not a true protein
  7. 3010379Species Human sars coronavirus [TaxId:227859] [369376] (1 PDB entry)
  8. 3010380Domain d6nurb_: 6nur B: [369377]
    automated match to d2ahmf_
    complexed with zn

Details for d6nurb_

PDB Entry: 6nur (more details), 3.1 Å

PDB Description: sars-coronavirus nsp12 bound to nsp7 and nsp8 co-factors
PDB Compounds: (B:) nsp8

SCOPe Domain Sequences for d6nurb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6nurb_ d.302.1.1 (B:) automated matches {Human sars coronavirus [TaxId: 227859]}
edkrakvtsamqtmlftmlrkldndalnniinnardgcvplniiplttaaklmvvvpdyg
tykntcdgntftyasalweiqqvvdadskivqlseinmdnspnlawplivtalra

SCOPe Domain Coordinates for d6nurb_:

Click to download the PDB-style file with coordinates for d6nurb_.
(The format of our PDB-style files is described here.)

Timeline for d6nurb_: