| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.302: Coronavirus NSP8-like [143075] (1 superfamily) core: alpha-beta(2)-alpha-beta(4)-alpha-beta; bifurcated barrel-like beta-sheet |
Superfamily d.302.1: Coronavirus NSP8-like [143076] (1 family) ![]() automatically mapped to Pfam PF08717 |
| Family d.302.1.1: Coronavirus NSP8-like [143077] (2 proteins) |
| Protein automated matches [369375] (3 species) not a true protein |
| Species Human sars coronavirus [TaxId:227859] [369376] (1 PDB entry) |
| Domain d6nurb_: 6nur B: [369377] automated match to d2ahmf_ complexed with zn |
PDB Entry: 6nur (more details), 3.1 Å
SCOPe Domain Sequences for d6nurb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6nurb_ d.302.1.1 (B:) automated matches {Human sars coronavirus [TaxId: 227859]}
edkrakvtsamqtmlftmlrkldndalnniinnardgcvplniiplttaaklmvvvpdyg
tykntcdgntftyasalweiqqvvdadskivqlseinmdnspnlawplivtalra
Timeline for d6nurb_: