Lineage for d6mhia_ (6mhi A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2970038Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2970344Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) (S)
    alpha-beta(2)-alpha(2)-beta(3)
  5. 2970345Family d.110.3.1: PYP-like [55786] (3 proteins)
  6. 2970346Protein Photoactive yellow protein, PYP [55787] (1 species)
  7. 2970347Species Methylophilus methylotrophus, strain w3a1 [TaxId:17] [55788] (84 PDB entries)
    Uniprot P16113
  8. 2970374Domain d6mhia_: 6mhi A: [369372]
    automated match to d1nwza_
    complexed with yyz

Details for d6mhia_

PDB Entry: 6mhi (more details), 1.35 Å

PDB Description: photoactive yellow protein with covalently bound 3,5-dichloro-4- hydroxycinnamic acid chromophore
PDB Compounds: (A:) Photoactive yellow protein

SCOPe Domain Sequences for d6mhia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6mhia_ d.110.3.1 (A:) Photoactive yellow protein, PYP {Methylophilus methylotrophus, strain w3a1 [TaxId: 17]}
mehvafgsedientlakmddgqldglafgaiqldgdgnilqynaaegditgrdpkqvigk
nffkdvapctdspefygkfkegvasgnlntmfeytfdyqmtptkvkvhmkkalsgdsywv
fvkrv

SCOPe Domain Coordinates for d6mhia_:

Click to download the PDB-style file with coordinates for d6mhia_.
(The format of our PDB-style files is described here.)

Timeline for d6mhia_: