Lineage for d6djib2 (6dji B:351-607)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2540800Fold d.136: Phospholipase D/nuclease [56023] (1 superfamily)
    beta-alpha-beta-alpha-beta-alpha-beta(4)-alpha; mixed sheet: order 1765234
  4. 2540801Superfamily d.136.1: Phospholipase D/nuclease [56024] (6 families) (S)
  5. 2540826Family d.136.1.3: Tyrosyl-DNA phosphodiesterase TDP1 [69815] (2 proteins)
  6. 2540827Protein Tyrosyl-DNA phosphodiesterase TDP1 [69816] (2 species)
  7. 2540837Species Human (Homo sapiens) [TaxId:9606] [69817] (36 PDB entries)
  8. 3069300Domain d6djib2: 6dji B:351-607 [369362]
    automated match to d1qzqa2
    complexed with edo, gog

Details for d6djib2

PDB Entry: 6dji (more details), 1.75 Å

PDB Description: crystal structure of tdp1 catalytic domain in complex with compound xz522
PDB Compounds: (B:) tyrosyl-DNA phosphodiesterase 1

SCOPe Domain Sequences for d6djib2:

Sequence, based on SEQRES records: (download)

>d6djib2 d.136.1.3 (B:351-607) Tyrosyl-DNA phosphodiesterase TDP1 {Human (Homo sapiens) [TaxId: 9606]}
nvyligstpgrfqgsqkdnwghfrlkkllkdhassmpnaeswpvvgqfssvgslgadesk
wlcsefkesmltlgkesktpgkssvplyliypsvenvrtslegypaggslpysiqtaekq
nwlhsyfhkwsaetsgrsnamphiktymrpspdfskiawflvtsanlskaawgalekngt
qlmirsyelgvlflpsafgldsfkvkqkffagsqepmatfpvpydlppelygskdrpwiw
nipyvkapdthgnmwvp

Sequence, based on observed residues (ATOM records): (download)

>d6djib2 d.136.1.3 (B:351-607) Tyrosyl-DNA phosphodiesterase TDP1 {Human (Homo sapiens) [TaxId: 9606]}
nvyligstpgrfqgsqkdnwghfrlkkllkdhassmpnaeswpvvgqfssvgslgadesk
wlcsefkesmltlgkesssvplyliypsvenvrtslegypaggslpysiqtaekqnwlhs
yfhkwsaetsgrsnamphiktymrpspdfskiawflvtsanlskaawgalekngtqlmir
syelgvlflpsafgldsfkvkqkffagpmatfpvpydlppelygskdrpwiwnipyvkap
dthgnmwvp

SCOPe Domain Coordinates for d6djib2:

Click to download the PDB-style file with coordinates for d6djib2.
(The format of our PDB-style files is described here.)

Timeline for d6djib2:

  • d6djib2 is new in SCOPe 2.07-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d6djib1