Lineage for d6ipla3 (6ipl A:290-494)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3006866Fold d.218: Nucleotidyltransferase [81302] (1 superfamily)
    core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123
  4. 3006867Superfamily d.218.1: Nucleotidyltransferase [81301] (16 families) (S)
  5. 3007364Family d.218.1.0: automated matches [227287] (1 protein)
    not a true family
  6. 3007365Protein automated matches [227105] (6 species)
    not a true protein
  7. 3007371Species Human (Homo sapiens) [TaxId:9606] [226559] (18 PDB entries)
  8. 3007374Domain d6ipla3: 6ipl A:290-494 [369359]
    Other proteins in same PDB: d6ipla1, d6ipla2
    automated match to d4lzda3
    protein/DNA complex; complexed with dtp, mg, so4

Details for d6ipla3

PDB Entry: 6ipl (more details), 1.64 Å

PDB Description: binary complex of human dna polymerase mu with mgdatp
PDB Compounds: (A:) DNA-directed DNA/RNA polymerase mu

SCOPe Domain Sequences for d6ipla3:

Sequence, based on SEQRES records: (download)

>d6ipla3 d.218.1.0 (A:290-494) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vlrsdvdalqqvveeavgqalpgatvtltggfrrgklqghdvdflithpkegqeagllpr
vmcrlqdqglilyhqhqhsccesptrlaqqshmdafersfcifrlpqpgswkavrvdlvv
apvsqfpfallgwtgsklfqrelrrfsrkekglwlnshglfdpeqktffqaaseedifrh
lgleylppeqrna

Sequence, based on observed residues (ATOM records): (download)

>d6ipla3 d.218.1.0 (A:290-494) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vlrsdvdalqqvveeavgqalpgatvtltggfrrgklqghdvdflithpkegqeagllpr
vmcrlqdqglilyhqhqhsafersfcifrlpqpgswkavrvdlvvapvsqfpfallgwtg
sklfqrelrrfsrkekglwlnshglfdpeqktffqaaseedifrhlgleylppeqrna

SCOPe Domain Coordinates for d6ipla3:

Click to download the PDB-style file with coordinates for d6ipla3.
(The format of our PDB-style files is described here.)

Timeline for d6ipla3: