SCOPe 2.08: Domain d6i24a1: 6i24 A:181-312

Lineage for d6i24a1 (6i24 A:181-312)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.110: Profilin-like [55769] (10 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families)
   alpha-beta(2)-alpha(2)-beta(3)

5. Family d.110.3.0: automated matches [191387] (1 protein)
   not a true family

6. Protein automated matches [190492] (24 species)
   not a true protein

7. Species Ochromonas danica [TaxId:2986] [369281] (6 PDB entries)

8. Domain d6i24a1: 6i24 A:181-312 [369347]
   Other proteins in same PDB: d6i24a2
   automated match to d5dklb_
   complexed with 5dd, 9o9, act, cl, edo, mg, peg

Details for d6i24a1

PDB Entry: 6i24, 1.43 Å

PDB Description: flavin analogue sheds light on light-oxygen-voltage domain mechanism

PDB Compounds: (A:) Aureochrome1-like protein

SCOPe Domain Sequences for d6i24a1:

Sequence; same for both SEQRES and ATOM records:

>d6i24a1 d.110.3.0 (A:181-312) automated matches {Ochromonas danica [TaxId: 2986]}
dyslvkalqtaqqnfvisdpsipdnpivyasqgfltltgyalsevlgrncrflqgpetdp
kavekvrkglergedttvvllnyrkdgstfwnqlfiaalrdgegnvvnylgvqckvsedy
akaflkneenek

Timeline for d6i24a1:

• d6i24a1 first appeared in SCOPe 2.07