SCOPe 2.08: Domain d6ipha2: 6iph A:231-289

Lineage for d6ipha2 (6iph A:231-289)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.60: SAM domain-like [47768] (17 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.12: PsbU/PolX domain-like [81585] (3 families)
   contains one classic and one pseudo HhH motifs

5. Family a.60.12.0: automated matches [254215] (1 protein)
   not a true family

6. Protein automated matches [254483] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [255047] (17 PDB entries)

8. Domain d6ipha2: 6iph A:231-289 [369339]
   Other proteins in same PDB: d6ipha1, d6ipha3
   automated match to d4lzda2
   protein/DNA complex; complexed with dtp, mn, so4

Details for d6ipha2

PDB Entry: 6iph, 1.65 Å

PDB Description: binary complex of human dna polymerase mu with mndatp

PDB Compounds: (A:) DNA-directed DNA/RNA polymerase mu

SCOPe Domain Sequences for d6ipha2:

Sequence; same for both SEQRES and ATOM records:

>d6ipha2 a.60.12.0 (A:231-289) automated matches {Human (Homo sapiens) [TaxId: 9606]}
seryqtmklftqifgvgvktadrwyreglrtlddlreqpqkltqqqkaglqhhqdlstp

Timeline for d6ipha2:

• d6ipha2 first appeared in SCOPe 2.07