SCOPe 2.08: Domain d6ipha1: 6iph A:137-230

Lineage for d6ipha1 (6iph A:137-230)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.60: SAM domain-like [47768] (17 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.6: DNA polymerase beta, N-terminal domain-like [47802] (2 families)
   contains one classic and one pseudo HhH motifs

5. Family a.60.6.0: automated matches [254214] (1 protein)
   not a true family

6. Protein automated matches [254482] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [255046] (17 PDB entries)

8. Domain d6ipha1: 6iph A:137-230 [369338]
   Other proteins in same PDB: d6ipha2, d6ipha3
   automated match to d4lzda1
   protein/DNA complex; complexed with dtp, mn, so4

Details for d6ipha1

PDB Entry: 6iph, 1.65 Å

PDB Description: binary complex of human dna polymerase mu with mndatp

PDB Compounds: (A:) DNA-directed DNA/RNA polymerase mu

SCOPe Domain Sequences for d6ipha1:

Sequence; same for both SEQRES and ATOM records:

>d6ipha1 a.60.6.0 (A:137-230) automated matches {Human (Homo sapiens) [TaxId: 9606]}
wmpayacqrptplthhntglsealeilaeaagfegsegrlltfcraasvlkalpspvttl
sqlqglphfgehssrvvqellehgvceevervrr

Timeline for d6ipha1:

• d6ipha1 first appeared in SCOPe 2.07