Lineage for d6ipia3 (6ipi A:290-494)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2563564Fold d.218: Nucleotidyltransferase [81302] (1 superfamily)
    core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123
  4. 2563565Superfamily d.218.1: Nucleotidyltransferase [81301] (16 families) (S)
  5. 2564030Family d.218.1.0: automated matches [227287] (1 protein)
    not a true family
  6. 2564031Protein automated matches [227105] (5 species)
    not a true protein
  7. 2564035Species Human (Homo sapiens) [TaxId:9606] [226559] (17 PDB entries)
  8. 3069270Domain d6ipia3: 6ipi A:290-494 [369332]
    Other proteins in same PDB: d6ipia1, d6ipia2
    automated match to d4lzda3
    protein/DNA complex; complexed with dcp, mn, so4

Details for d6ipia3

PDB Entry: 6ipi (more details), 1.8 Å

PDB Description: binary complex of human dna polymerase mu with mndctp
PDB Compounds: (A:) DNA-directed DNA/RNA polymerase mu

SCOPe Domain Sequences for d6ipia3:

Sequence, based on SEQRES records: (download)

>d6ipia3 d.218.1.0 (A:290-494) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vlrsdvdalqqvveeavgqalpgatvtltggfrrgklqghdvdflithpkegqeagllpr
vmcrlqdqglilyhqhqhsccesptrlaqqshmdafersfcifrlpqpgswkavrvdlvv
apvsqfpfallgwtgsklfqrelrrfsrkekglwlnshglfdpeqktffqaaseedifrh
lgleylppeqrna

Sequence, based on observed residues (ATOM records): (download)

>d6ipia3 d.218.1.0 (A:290-494) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vlrsdvdalqqvveeavgqalpgatvtltggfrrgklqghdvdflithpkegqeagllpr
vmcrlqdqglilyhqhqhsccafersfcifrlpqpgswkavrvdlvvapvsqfpfallgw
tgsklfqrelrrfsrkekglwlnshglfdpeqktffqaaseedifrhlgleylppeqrna

SCOPe Domain Coordinates for d6ipia3:

Click to download the PDB-style file with coordinates for d6ipia3.
(The format of our PDB-style files is described here.)

Timeline for d6ipia3:

  • d6ipia3 is new in SCOPe 2.07-stable