Lineage for d6ipia1 (6ipi A:137-230)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2715427Fold a.60: SAM domain-like [47768] (17 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2715906Superfamily a.60.6: DNA polymerase beta, N-terminal domain-like [47802] (2 families) (S)
    contains one classic and one pseudo HhH motifs
  5. 2716133Family a.60.6.0: automated matches [254214] (1 protein)
    not a true family
  6. 2716134Protein automated matches [254482] (3 species)
    not a true protein
  7. 2716135Species Human (Homo sapiens) [TaxId:9606] [255046] (17 PDB entries)
  8. 2716147Domain d6ipia1: 6ipi A:137-230 [369330]
    Other proteins in same PDB: d6ipia2, d6ipia3
    automated match to d4lzda1
    protein/DNA complex; complexed with dcp, mn, so4

Details for d6ipia1

PDB Entry: 6ipi (more details), 1.8 Å

PDB Description: binary complex of human dna polymerase mu with mndctp
PDB Compounds: (A:) DNA-directed DNA/RNA polymerase mu

SCOPe Domain Sequences for d6ipia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ipia1 a.60.6.0 (A:137-230) automated matches {Human (Homo sapiens) [TaxId: 9606]}
wmpayacqrptplthhntglsealeilaeaagfegsegrlltfcraasvlkalpspvttl
sqlqglphfgehssrvvqellehgvceevervrr

SCOPe Domain Coordinates for d6ipia1:

Click to download the PDB-style file with coordinates for d6ipia1.
(The format of our PDB-style files is described here.)

Timeline for d6ipia1: