Lineage for d6djgb1 (6djg B:162-350)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.136: Phospholipase D/nuclease [56023] (1 superfamily)
    beta-alpha-beta-alpha-beta-alpha-beta(4)-alpha; mixed sheet: order 1765234
  4. Superfamily d.136.1: Phospholipase D/nuclease [56024] (6 families) (S)
  5. Family d.136.1.3: Tyrosyl-DNA phosphodiesterase TDP1 [69815] (2 proteins)
  6. Protein Tyrosyl-DNA phosphodiesterase TDP1 [69816] (2 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [69817] (36 PDB entries)
  8. Domain d6djgb1: 6djg B:162-350 [369300]
    automated match to d1qzqa1
    complexed with edo, gnj

Details for d6djgb1

PDB Entry: 6djg (more details), 1.8800000000000001 Å

PDB Description: crystal structure of tdp1 catalytic domain in complex with compound xz503
PDB Compounds: (B:) tyrosyl-DNA phosphodiesterase 1

SCOPe Domain Sequences for d6djgb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6djgb1 d.136.1.3 (B:162-350) Tyrosyl-DNA phosphodiesterase TDP1 {Human (Homo sapiens) [TaxId: 9606]}
npfqfyltrvsgvkpkynsgalhikdilsplfgtlvssaqfnycfdvdwlvkqyppefrk
kpillvhgdkreakahlhaqakpyenislcqakldiafgthhtkmmlllyeeglrvviht
snlihadwhqktqgiwlsplypriadgthksgespthfkadlisylmaynapslkewidv
ihkhdlset

SCOPe Domain Coordinates for d6djgb1 are not available.

Timeline for d6djgb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6djgb2
View in 3D
Domains from other chains:
(mouse over for more information)
d6djga1, d6djga2