Lineage for d6i22a1 (6i22 A:181-311)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2970038Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2970344Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) (S)
    alpha-beta(2)-alpha(2)-beta(3)
  5. 2970628Family d.110.3.0: automated matches [191387] (1 protein)
    not a true family
  6. 2970629Protein automated matches [190492] (24 species)
    not a true protein
  7. 2970760Species Ochromonas danica [TaxId:2986] [369281] (6 PDB entries)
  8. 2970767Domain d6i22a1: 6i22 A:181-311 [369289]
    Other proteins in same PDB: d6i22a2, d6i22b2, d6i22c2, d6i22d2
    automated match to d5dklb_
    complexed with fmn

Details for d6i22a1

PDB Entry: 6i22 (more details), 1.66 Å

PDB Description: flavin analogue sheds light on light-oxygen-voltage domain mechanism
PDB Compounds: (A:) Aureochrome1-like protein

SCOPe Domain Sequences for d6i22a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6i22a1 d.110.3.0 (A:181-311) automated matches {Ochromonas danica [TaxId: 2986]}
dyslvkalqtaqqnfvisdpsipdnpivyasqgfltltgyalsevlgrncrflqgpetdp
kavekvrkglergedttvvllnyrkdgstfwnqlfiaalrdgegnvvnylgvqckvsedy
akaflkneene

SCOPe Domain Coordinates for d6i22a1:

Click to download the PDB-style file with coordinates for d6i22a1.
(The format of our PDB-style files is described here.)

Timeline for d6i22a1: