![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.110: Profilin-like [55769] (10 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
![]() | Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) ![]() alpha-beta(2)-alpha(2)-beta(3) |
![]() | Family d.110.3.0: automated matches [191387] (1 protein) not a true family |
![]() | Protein automated matches [190492] (24 species) not a true protein |
![]() | Species Ochromonas danica [TaxId:2986] [369281] (6 PDB entries) |
![]() | Domain d6i22b1: 6i22 B:181-311 [369283] Other proteins in same PDB: d6i22a2, d6i22b2, d6i22c2, d6i22d2 automated match to d5dklb_ complexed with fmn |
PDB Entry: 6i22 (more details), 1.66 Å
SCOPe Domain Sequences for d6i22b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6i22b1 d.110.3.0 (B:181-311) automated matches {Ochromonas danica [TaxId: 2986]} dyslvkalqtaqqnfvisdpsipdnpivyasqgfltltgyalsevlgrncrflqgpetdp kavekvrkglergedttvvllnyrkdgstfwnqlfiaalrdgegnvvnylgvqckvsedy akaflkneene
Timeline for d6i22b1: