![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.60: SAM domain-like [47768] (16 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
![]() | Superfamily a.60.6: DNA polymerase beta, N-terminal domain-like [47802] (2 families) ![]() contains one classic and one pseudo HhH motifs |
![]() | Family a.60.6.0: automated matches [254214] (1 protein) not a true family |
![]() | Protein automated matches [254482] (3 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [255046] (17 PDB entries) |
![]() | Domain d6aeha1: 6aeh A:138-230 [369278] Other proteins in same PDB: d6aeha2, d6aeha3 automated match to d4lzda1 protein/DNA complex; complexed with mn, so4, utp |
PDB Entry: 6aeh (more details), 1.64 Å
SCOPe Domain Sequences for d6aeha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6aeha1 a.60.6.0 (A:138-230) automated matches {Human (Homo sapiens) [TaxId: 9606]} mpayacqrptplthhntglsealeilaeaagfegsegrlltfcraasvlkalpspvttls qlqglphfgehssrvvqellehgvceevervrr
Timeline for d6aeha1: