Lineage for d6aa2c1 (6aa2 C:5-238)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2508387Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2508388Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2508389Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)
  6. 2508393Protein Green fluorescent protein, GFP [54513] (5 species)
  7. 2508399Species Jellyfish (Aequorea victoria) [TaxId:6100] [54514] (272 PDB entries)
    Uniprot P42212
  8. 3069210Domain d6aa2c1: 6aa2 C:5-238 [369272]
    Other proteins in same PDB: d6aa2b2, d6aa2c2
    automated match to d3srya_

Details for d6aa2c1

PDB Entry: 6aa2 (more details), 2.3 Å

PDB Description: x-ray structure of reqy1 (oxidized form)
PDB Compounds: (C:) Green fluorescent protein

SCOPe Domain Sequences for d6aa2c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6aa2c1 d.22.1.1 (C:5-238) Green fluorescent protein, GFP {Jellyfish (Aequorea victoria) [TaxId: 6100]}
eelftgvvpilveldgdvnghrfsvsgegegdatygkltlklicttgklpvpwptlvttl
gygvqcfarypdhmkqhdffksampegyvqertiffkddgnyktraevkfegdtlvnrie
lkgidfkedgnilghkleyngwcahniyitadkqkngikanfkirhniedggvqladhyq
qntpigdgpvllpdnhylsycsalskdpnekrdhmvllefvtaagitlgmdelyk

SCOPe Domain Coordinates for d6aa2c1:

Click to download the PDB-style file with coordinates for d6aa2c1.
(The format of our PDB-style files is described here.)

Timeline for d6aa2c1:

  • d6aa2c1 is new in SCOPe 2.07-stable