Lineage for d6djga2 (6djg A:351-607)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.136: Phospholipase D/nuclease [56023] (1 superfamily)
    beta-alpha-beta-alpha-beta-alpha-beta(4)-alpha; mixed sheet: order 1765234
  4. Superfamily d.136.1: Phospholipase D/nuclease [56024] (6 families) (S)
  5. Family d.136.1.3: Tyrosyl-DNA phosphodiesterase TDP1 [69815] (2 proteins)
  6. Protein Tyrosyl-DNA phosphodiesterase TDP1 [69816] (2 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [69817] (36 PDB entries)
  8. Domain d6djga2: 6djg A:351-607 [369262]
    automated match to d1qzqa2
    complexed with edo, gnj

Details for d6djga2

PDB Entry: 6djg (more details), 1.8800000000000001 Å

PDB Description: crystal structure of tdp1 catalytic domain in complex with compound xz503
PDB Compounds: (A:) tyrosyl-DNA phosphodiesterase 1

SCOPe Domain Sequences for d6djga2:

Sequence, based on SEQRES records: (download)

>d6djga2 d.136.1.3 (A:351-607) Tyrosyl-DNA phosphodiesterase TDP1 {Human (Homo sapiens) [TaxId: 9606]}
nvyligstpgrfqgsqkdnwghfrlkkllkdhassmpnaeswpvvgqfssvgslgadesk
wlcsefkesmltlgkesktpgkssvplyliypsvenvrtslegypaggslpysiqtaekq
nwlhsyfhkwsaetsgrsnamphiktymrpspdfskiawflvtsanlskaawgalekngt
qlmirsyelgvlflpsafgldsfkvkqkffagsqepmatfpvpydlppelygskdrpwiw
nipyvkapdthgnmwvp

Sequence, based on observed residues (ATOM records): (download)

>d6djga2 d.136.1.3 (A:351-607) Tyrosyl-DNA phosphodiesterase TDP1 {Human (Homo sapiens) [TaxId: 9606]}
nvyligstpgrfqgsqkdnwghfrlkkllkdhassmpnaeswpvvgqfssvgslgadesk
wlcsefkesmltlgkesssvplyliypsvenvrtslegypaggslpysiqtaekqnwlhs
yfhkwsaetsgrsnamphiktymrpspdfskiawflvtsanlskaawgalekngtqlmir
syelgvlflpsafgldsfkvkqkffagpmatfpvpydlppelygskdrpwiwnipyvkap
dthgnmwvp

SCOPe Domain Coordinates for d6djga2 are not available.

Timeline for d6djga2:

View in 3D
Domains from same chain:
(mouse over for more information)
d6djga1
View in 3D
Domains from other chains:
(mouse over for more information)
d6djgb1, d6djgb2