Lineage for d6aeca2 (6aec A:231-289)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2324209Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2325087Superfamily a.60.12: PsbU/PolX domain-like [81585] (3 families) (S)
    contains one classic and one pseudo HhH motifs
  5. 2325352Family a.60.12.0: automated matches [254215] (1 protein)
    not a true family
  6. 2325353Protein automated matches [254483] (3 species)
    not a true protein
  7. 2325354Species Human (Homo sapiens) [TaxId:9606] [255047] (17 PDB entries)
  8. 3069192Domain d6aeca2: 6aec A:231-289 [369254]
    Other proteins in same PDB: d6aeca1, d6aeca3
    automated match to d4lzda2
    protein/DNA complex; complexed with atp, mn, so4

Details for d6aeca2

PDB Entry: 6aec (more details), 1.72 Å

PDB Description: binary complex of human dna polymerase mu with mnatp
PDB Compounds: (A:) DNA-directed DNA/RNA polymerase mu

SCOPe Domain Sequences for d6aeca2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6aeca2 a.60.12.0 (A:231-289) automated matches {Human (Homo sapiens) [TaxId: 9606]}
seryqtmklftqifgvgvktadrwyreglrtlddlreqpqkltqqqkaglqhhqdlstp

SCOPe Domain Coordinates for d6aeca2:

Click to download the PDB-style file with coordinates for d6aeca2.
(The format of our PDB-style files is described here.)

Timeline for d6aeca2:

  • d6aeca2 is new in SCOPe 2.07-stable