Lineage for d6aa2a_ (6aa2 A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)
  6. Protein Green fluorescent protein, GFP [54513] (6 species)
  7. Species Jellyfish (Aequorea victoria) [TaxId:6100] [54514] (282 PDB entries)
    Uniprot P42212
  8. Domain d6aa2a_: 6aa2 A: [369248]
    Other proteins in same PDB: d6aa2b2, d6aa2c2
    automated match to d3srya_

Details for d6aa2a_

PDB Entry: 6aa2 (more details), 2.3 Å

PDB Description: x-ray structure of reqy1 (oxidized form)
PDB Compounds: (A:) Green fluorescent protein

SCOPe Domain Sequences for d6aa2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6aa2a_ d.22.1.1 (A:) Green fluorescent protein, GFP {Jellyfish (Aequorea victoria) [TaxId: 6100]}
eelftgvvpilveldgdvnghrfsvsgegegdatygkltlklicttgklpvpwptlvttl
gygvqcfarypdhmkqhdffksampegyvqertiffkddgnyktraevkfegdtlvnrie
lkgidfkedgnilghkleyngwcahniyitadkqkngikanfkirhniedggvqladhyq
qntpigdgpvllpdnhylsycsalskdpnekrdhmvllefvtaagi

SCOPe Domain Coordinates for d6aa2a_ are not available.

Timeline for d6aa2a_:

Domains from other chains:
(mouse over for more information)
d6aa2b1, d6aa2b2, d6aa2c1, d6aa2c2