Lineage for d5zsza2 (5zsz A:143-293)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) (S)
  5. Family d.32.1.0: automated matches [191344] (1 protein)
    not a true family
  6. Protein automated matches [190239] (26 species)
    not a true protein
  7. Species Diaphorobacter sp. [TaxId:1302548] [367955] (3 PDB entries)
  8. Domain d5zsza2: 5zsz A:143-293 [369246]
    automated match to d3hq0c2
    complexed with ca, fe

Details for d5zsza2

PDB Entry: 5zsz (more details), 2.4 Å

PDB Description: catechol 2,3-dioxygenase (c23o64) from diaphorobacter sp ds2
PDB Compounds: (A:) Catechol 2,3-dioxygenase, Extradiol ring cleavage protein

SCOPe Domain Sequences for d5zsza2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5zsza2 d.32.1.0 (A:143-293) automated matches {Diaphorobacter sp. [TaxId: 1302548]}
agahwldhcllvcemnpeagintvadntrfvtecldfflteqvlvgpggsiqattflart
ttphdiafvggptsglhhiaffldswhdvlkaadvmaknkvridvaptrhgitrgetiyf
fdpsgnrnetfaglgylaqrdrpvttwtedq

SCOPe Domain Coordinates for d5zsza2 are not available.

Timeline for d5zsza2:

Domains from same chain:
(mouse over for more information)
d5zsza1