Lineage for d5zxhe_ (5zxh E:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2339505Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
    not a true fold
  4. 2339704Superfamily a.137.10: Stathmin [101494] (1 family) (S)
    single long helix crosslinking four tubulin subunits
    automatically mapped to Pfam PF00836
  5. 2339705Family a.137.10.1: Stathmin [101495] (2 proteins)
  6. 2339706Protein Stathmin 4 [101496] (2 species)
  7. 2339707Species Norway rat (Rattus norvegicus) [TaxId:10116] [101497] (99 PDB entries)
  8. 3069171Domain d5zxhe_: 5zxh E: [369233]
    Other proteins in same PDB: d5zxha1, d5zxha2, d5zxhb1, d5zxhb2, d5zxhc1, d5zxhc2, d5zxhd1, d5zxhd2, d5zxhf1, d5zxhf2
    automated match to d4i55e_
    complexed with 9lx, acp, ca, gdp, gtp, mes, mg

Details for d5zxhe_

PDB Entry: 5zxh (more details), 2.8 Å

PDB Description: the structure of mt189-tubulin complex
PDB Compounds: (E:) Stathmin-4

SCOPe Domain Sequences for d5zxhe_:

Sequence, based on SEQRES records: (download)

>d5zxhe_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mevielnkctsgqsfevilkppsfdgvpefnaslprrrdpsleeiqkkleaaeerrkyqe
aellkhlaekrehereviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqe
kdkhaeevrknkelke

Sequence, based on observed residues (ATOM records): (download)

>d5zxhe_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mevielnkctsgqsfevilkppdpsleeiqkkleaaeerrkyqeaellkhlaekrehere
viqkaieennnfikmakeklaqkmesnkenreahlaamlerlqekdkhaeevrknkelke

SCOPe Domain Coordinates for d5zxhe_:

Click to download the PDB-style file with coordinates for d5zxhe_.
(The format of our PDB-style files is described here.)

Timeline for d5zxhe_:

  • d5zxhe_ appears in periodic updates to SCOPe 2.07 starting on 2019-05-23