Lineage for d5zkva_ (5zkv A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2303644Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 2303645Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 2303646Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)
  6. 2303863Protein Mitochondrial cytochrome c [46642] (7 species)
  7. 2303981Species Horse (Equus caballus) [TaxId:9796] [46644] (27 PDB entries)
    Uniprot P00004
  8. 3069169Domain d5zkva_: 5zkv A: [369231]
    automated match to d3o1ya_
    complexed with hec; mutant

Details for d5zkva_

PDB Entry: 5zkv (more details)

PDB Description: solution structure of molten globule state of l94g mutant of horse cytochrome-c
PDB Compounds: (A:) cytochrome c

SCOPe Domain Sequences for d5zkva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5zkva_ a.3.1.1 (A:) Mitochondrial cytochrome c {Horse (Equus caballus) [TaxId: 9796]}
gdvekgkkifvqkcaqchtvekggkhktgpnlhglfgrktgqapgftytdanknkgitwk
eetlmeylenpkkyipgtkmifagikkkteredgiaylkkatne

SCOPe Domain Coordinates for d5zkva_:

Click to download the PDB-style file with coordinates for d5zkva_.
(The format of our PDB-style files is described here.)

Timeline for d5zkva_:

  • d5zkva_ appears in periodic updates to SCOPe 2.07 starting on 2019-05-23