Lineage for d5zxhd2 (5zxh D:244-431)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2525085Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2525406Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) (S)
  5. 2525407Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)
  6. 2525526Protein automated matches [227071] (5 species)
    not a true protein
  7. 2525736Species Sheep (Ovis aries) [TaxId:9940] [226224] (19 PDB entries)
  8. 3069168Domain d5zxhd2: 5zxh D:244-431 [369230]
    Other proteins in same PDB: d5zxha1, d5zxhb1, d5zxhc1, d5zxhd1, d5zxhe_, d5zxhf1, d5zxhf2
    automated match to d3rycd2
    complexed with 9lx, acp, ca, gdp, gtp, mes, mg

Details for d5zxhd2

PDB Entry: 5zxh (more details), 2.8 Å

PDB Description: the structure of mt189-tubulin complex
PDB Compounds: (D:) Tubulin beta-2B chain

SCOPe Domain Sequences for d5zxhd2:

Sequence, based on SEQRES records: (download)

>d5zxhd2 d.79.2.1 (D:244-431) automated matches {Sheep (Ovis aries) [TaxId: 9940]}
gqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdsknmmaac
dprhgryltvaavfrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkm
satfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyq
qyqdatad

Sequence, based on observed residues (ATOM records): (download)

>d5zxhd2 d.79.2.1 (D:244-431) automated matches {Sheep (Ovis aries) [TaxId: 9940]}
gqlnadlrklavnmvpfprlhffmpgfaplltvpeltqqmfdsknmmaacdprhgryltv
aavfrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkmsatfignsta
iqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyqqyqdatad

SCOPe Domain Coordinates for d5zxhd2:

Click to download the PDB-style file with coordinates for d5zxhd2.
(The format of our PDB-style files is described here.)

Timeline for d5zxhd2:

  • d5zxhd2 appears in periodic updates to SCOPe 2.07 starting on 2019-05-23