Lineage for d5zxhd1 (5zxh D:1-243)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2445156Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2445157Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) (S)
    automatically mapped to Pfam PF00091
  5. 2445158Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)
  6. 2445283Protein automated matches [226837] (7 species)
    not a true protein
  7. 2445493Species Sheep (Ovis aries) [TaxId:9940] [224884] (19 PDB entries)
  8. 3069167Domain d5zxhd1: 5zxh D:1-243 [369229]
    Other proteins in same PDB: d5zxha2, d5zxhb2, d5zxhc2, d5zxhd2, d5zxhe_, d5zxhf1, d5zxhf2
    automated match to d4drxb1
    complexed with 9lx, acp, ca, gdp, gtp, mes, mg

Details for d5zxhd1

PDB Entry: 5zxh (more details), 2.8 Å

PDB Description: the structure of mt189-tubulin complex
PDB Compounds: (D:) Tubulin beta-2B chain

SCOPe Domain Sequences for d5zxhd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5zxhd1 c.32.1.1 (D:1-243) automated matches {Sheep (Ovis aries) [TaxId: 9940]}
mreivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneatgnkyv
prailvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvv
rkesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvvpspkvsdtvv
epynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttcl
rfp

SCOPe Domain Coordinates for d5zxhd1:

Click to download the PDB-style file with coordinates for d5zxhd1.
(The format of our PDB-style files is described here.)

Timeline for d5zxhd1:

  • d5zxhd1 appears in periodic updates to SCOPe 2.07 starting on 2019-05-23