SCOPe 2.07: Domain d5zs7c_: 5zs7 C:

Lineage for d5zs7c_ (5zs7 C:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 324156; strand 5 is antiparallel to the rest

4. Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (4 families)

5. Family c.60.1.1: Cofactor-dependent phosphoglycerate mutase [53255] (4 proteins)

6. Protein automated matches [190196] (7 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186938] (20 PDB entries)

8. Domain d5zs7c_: 5zs7 C: [369219]
   automated match to d1yjxe_
   complexed with aly, cl, mes

Details for d5zs7c_

PDB Entry: 5zs7, 2.68 Å

PDB Description: acetylation of lysine 100 in phosphoglycerate mutase 1

PDB Compounds: (C:) phosphoglycerate mutase 1

SCOPe Domain Sequences for d5zs7c_:

Sequence; same for both SEQRES and ATOM records:

>d5zs7c_ c.60.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aayklvlirhgesawnlenrfsgwydadlspagheeakrggqalrdagyefdicftsvqk
rairtlwtvldaidqmwlpvvrtwrlnerhyggltglnkaetaakhgeaqvkiwrrsydv
ppppmepdhpfysniskdrryadltedqlpsceslkdtiaralpfwneeivpqikegkrv
liaahgnslrgivkhleglseeaimelnlptgipivyeldknlkpikpmqflgd

Timeline for d5zs7c_:

• d5zs7c_ is new in SCOPe 2.07-stable
  
• d5zs7c_ appears in the current release, SCOPe 2.08