Lineage for d6ovwa1 (6ovw A:1-151)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2513848Fold c.78: ATC-like [53670] (2 superfamilies)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134
  4. 2513849Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families) (S)
  5. 2514304Family c.78.1.0: automated matches [227206] (1 protein)
    not a true family
  6. 2514305Protein automated matches [226938] (26 species)
    not a true protein
  7. 2514585Species Salmonella typhimurium [TaxId:216597] [369212] (1 PDB entry)
  8. 2514586Domain d6ovwa1: 6ovw A:1-151 [369213]
    Other proteins in same PDB: d6ovwa2
    automated match to d1duvg1
    complexed with gol, po4

Details for d6ovwa1

PDB Entry: 6ovw (more details), 1.9 Å

PDB Description: crystal structure of ornithine carbamoyltransferase from salmonella enterica
PDB Compounds: (A:) ornithine carbamoyltransferase

SCOPe Domain Sequences for d6ovwa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ovwa1 c.78.1.0 (A:1-151) automated matches {Salmonella typhimurium [TaxId: 216597]}
mstfyqkpflklldftaseltallqlaaklkadkkngkeeqklvgknialifekdstrtr
csfevaaydqgarvtylgssgsqighkesikdtarvlgrmfdgiqyrgygqeivetlaey
sgvpvwngltdeyhptqlladlltmqehlpg

SCOPe Domain Coordinates for d6ovwa1:

Click to download the PDB-style file with coordinates for d6ovwa1.
(The format of our PDB-style files is described here.)

Timeline for d6ovwa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6ovwa2