SCOPe 2.08: Domain d6ovwa1: 6ovw A:1-151

Lineage for d6ovwa1 (6ovw A:1-151)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.78: ATC-like [53670] (2 superfamilies)
   consists of two similar domains related by pseudo dyad; duplication
   core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families)

5. Family c.78.1.0: automated matches [227206] (1 protein)
   not a true family

6. Protein automated matches [226938] (26 species)
   not a true protein

7. Species Salmonella typhimurium [TaxId:216597] [369212] (1 PDB entry)

8. Domain d6ovwa1: 6ovw A:1-151 [369213]
   Other proteins in same PDB: d6ovwa2
   automated match to d1duvg1
   complexed with gol, po4

Details for d6ovwa1

PDB Entry: 6ovw, 1.9 Å

PDB Description: crystal structure of ornithine carbamoyltransferase from salmonella enterica

PDB Compounds: (A:) ornithine carbamoyltransferase

SCOPe Domain Sequences for d6ovwa1:

Sequence; same for both SEQRES and ATOM records:

>d6ovwa1 c.78.1.0 (A:1-151) automated matches {Salmonella typhimurium [TaxId: 216597]}
mstfyqkpflklldftaseltallqlaaklkadkkngkeeqklvgknialifekdstrtr
csfevaaydqgarvtylgssgsqighkesikdtarvlgrmfdgiqyrgygqeivetlaey
sgvpvwngltdeyhptqlladlltmqehlpg

Timeline for d6ovwa1:

• d6ovwa1 first appeared in SCOPe 2.07