SCOPe 2.08: Domain d6o0pa_: 6o0p A:

Lineage for d6o0pa_ (6o0p A:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
   multi-helical domains of various folds which is thought to unfold in the membrane

4. Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families)
   PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain

5. Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins)
   Pfam PF00452

6. Protein Bcl-2 [64524] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [64525] (18 PDB entries)

8. Domain d6o0pa_: 6o0p A: [369165]
   automated match to d2o22a_
   complexed with lbm, peg; mutant

Details for d6o0pa_

PDB Entry: 6o0p, 1.8 Å

PDB Description: crystal structure of bcl-2 g101a mutation with venetoclax

PDB Compounds: (A:) Apoptosis regulator Bcl-2,Bcl-2-like protein 1,Apoptosis regulator Bcl-2

SCOPe Domain Sequences for d6o0pa_:

Sequence, based on SEQRES records:

>d6o0pa_ f.1.4.1 (A:) Bcl-2 {Human (Homo sapiens) [TaxId: 9606]}
ydnreivmkyihyklsqrgyewdagddveenrteapegtesevvhltlrqaaddfsrryr
rdfaemssqlhltpftargrfatvveelfrdgvnwgrivaffefggvmcvesvnremspl
vdnialwmteylnrhlhtwiqdnggwdafvelyg

Sequence, based on observed residues (ATOM records):

>d6o0pa_ f.1.4.1 (A:) Bcl-2 {Human (Homo sapiens) [TaxId: 9606]}
ydnreivmkyihyklsqrgyewdagddsevvhltlrqaaddfsrryrrdfaemssqlhlt
pftargrfatvveelfrdgvnwgrivaffefggvmcvesvnremsplvdnialwmteyln
rhlhtwiqdnggwdafvelyg

Timeline for d6o0pa_:

• d6o0pa_ first appeared in SCOPe 2.07