SCOPe 2.07: Domain d6n9ab1: 6n9a B:2-103

Lineage for d6n9ab1 (6n9a B:2-103)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.0: automated matches [227137] (1 protein)
   not a true family

6. Protein automated matches [226839] (63 species)
   not a true protein

7. Species Thermotoga maritima [TaxId:2336] [369151] (1 PDB entry)

8. Domain d6n9ab1: 6n9a B:2-103 [369152]
   Other proteins in same PDB: d6n9ab2, d6n9ab3
   automated match to d2a6aa1
   protein/RNA complex; complexed with adp, ae3, atp, kg4, mg, pge, zn

Details for d6n9ab1

PDB Entry: 6n9a, 2.5 Å

PDB Description: crystal structure of thermotoga maritima threonylcarbamoyladenosine biosynthesis complex tsab2d2e2 bound to atp and carboxy-amp

PDB Compounds: (B:) tRNA threonylcarbamoyladenosine biosynthesis protein tsab

SCOPe Domain Sequences for d6n9ab1:

Sequence; same for both SEQRES and ATOM records:

>d6n9ab1 c.55.1.0 (B:2-103) automated matches {Thermotoga maritima [TaxId: 2336]}
nvlaldtsqririglrkgedlfeisytgekkhaeilpvvvkklldeldlkvkdldvvgvg
igpggltglrvgiatvvglvspydipvaplnsfemtakscpa

Timeline for d6n9ab1:

• d6n9ab1 is new in SCOPe 2.07-stable
  
• d6n9ab1 appears in the current release, SCOPe 2.08