Lineage for d6ggua2 (6ggu A:245-344)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
    multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry
  4. Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) (S)
    N-terminal domain is Rossmann-fold with a family-specific C-terminal extension
  5. Family a.100.1.0: automated matches [227147] (1 protein)
    not a true family
  6. Protein automated matches [226851] (46 species)
    not a true protein
  7. Species Methanothermobacter marburgensis [TaxId:79929] [235008] (4 PDB entries)
  8. Domain d6ggua2: 6ggu A:245-344 [369136]
    Other proteins in same PDB: d6ggua1
    automated match to d4jjfa2
    complexed with fe9, gol, mes, so4

Details for d6ggua2

PDB Entry: 6ggu (more details), 2.6 Å

PDB Description: crystal structure of native fe-hydrogenase from methanothermobacter marburgensis
PDB Compounds: (A:) 5,10-methenyltetrahydromethanopterin hydrogenase

SCOPe Domain Sequences for d6ggua2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ggua2 a.100.1.0 (A:245-344) automated matches {Methanothermobacter marburgensis [TaxId: 79929]}
aellgpvcdmcsaltaityagilsyrdsvtqvlgapasfaqmmakesleqitalmekvgi
dkmeenldpgallgtadsmnfgasaeilptvfeilekrkk

SCOPe Domain Coordinates for d6ggua2 are not available.

Timeline for d6ggua2:

Domains from same chain:
(mouse over for more information)
d6ggua1