Lineage for d6ggua1 (6ggu A:1-244)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2449371Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2449372Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2454167Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2454168Protein automated matches [190069] (309 species)
    not a true protein
  7. 2455973Species Methanothermobacter marburgensis [TaxId:79929] [235006] (4 PDB entries)
  8. 2455979Domain d6ggua1: 6ggu A:1-244 [369135]
    Other proteins in same PDB: d6ggua2
    automated match to d4jjfa1
    complexed with fe9, gol, mes, so4

Details for d6ggua1

PDB Entry: 6ggu (more details), 2.6 Å

PDB Description: crystal structure of native fe-hydrogenase from methanothermobacter marburgensis
PDB Compounds: (A:) 5,10-methenyltetrahydromethanopterin hydrogenase

SCOPe Domain Sequences for d6ggua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ggua1 c.2.1.0 (A:1-244) automated matches {Methanothermobacter marburgensis [TaxId: 79929]}
mklailgagcyrthaasgitnfsracevaemvgkpeiamthstitmgaelkelagvdevv
vadpvfdnqftviddfayedvieahkedpekimpqirekvnevakelpkppegaihfthp
edlgfeittddreavadadfimtwfpkgdmqpdiinkfiddikpgaivthactipttkfy
kifeqkhgdlvtkpetlnvtsyhpgavpemkgqvyiaegyasedaietlfelgqkargna
yrlp

SCOPe Domain Coordinates for d6ggua1:

Click to download the PDB-style file with coordinates for d6ggua1.
(The format of our PDB-style files is described here.)

Timeline for d6ggua1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6ggua2