Lineage for d6iafa_ (6iaf A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2314150Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2314151Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2314152Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 2315402Protein automated matches [190041] (34 species)
    not a true protein
  7. 2315948Species Lithobates catesbeiana [TaxId:8400] [323613] (9 PDB entries)
  8. 2315955Domain d6iafa_: 6iaf A: [369132]
    automated match to d3shxa_
    complexed with cl, fe2, mg

Details for d6iafa_

PDB Entry: 6iaf (more details), 1.35 Å

PDB Description: fifteen minutes iron loaded rana catesbeiana h' ferritin variant h54n
PDB Compounds: (A:) Ferritin, middle subunit

SCOPe Domain Sequences for d6iafa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6iafa_ a.25.1.1 (A:) automated matches {Lithobates catesbeiana [TaxId: 8400]}
vsqvrqnyhsdceaavnrmlnlelyasytyssmyaffdrddvalhnvaeffkensheere
haekfmkyqnkrggrvvlqdikkperdewgntleamqaalqlektvnqalldlhklatdk
vdphlcdfleseyleeqvkdikrigdfitnlkrlglpengmgeylfdkhsvk

SCOPe Domain Coordinates for d6iafa_:

Click to download the PDB-style file with coordinates for d6iafa_.
(The format of our PDB-style files is described here.)

Timeline for d6iafa_: