Class b: All beta proteins [48724] (180 folds) |
Fold b.38: Sm-like fold [50181] (5 superfamilies) core: barrel, open; n*=4, S*=8; meander; SH3-like topology |
Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) |
Family b.38.1.0: automated matches [191538] (1 protein) not a true family |
Protein automated matches [190914] (14 species) not a true protein |
Species Caulobacter vibrioides [TaxId:190650] [369058] (1 PDB entry) |
Domain d6gwkf_: 6gwk F: [369120] automated match to d3inzf_ |
PDB Entry: 6gwk (more details), 2.15 Å
SCOPe Domain Sequences for d6gwkf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6gwkf_ b.38.1.0 (F:) automated matches {Caulobacter vibrioides [TaxId: 190650]} qnlqdtflnsvrksktpltiflvngvklqgvvswfdnfcvllrrdgqsqlvykhaistim paqpvqly
Timeline for d6gwkf_: