Lineage for d6gwkf_ (6gwk F:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2786770Fold b.38: Sm-like fold [50181] (5 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 2786771Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) (S)
  5. 2787428Family b.38.1.0: automated matches [191538] (1 protein)
    not a true family
  6. 2787429Protein automated matches [190914] (14 species)
    not a true protein
  7. 2787509Species Caulobacter vibrioides [TaxId:190650] [369058] (1 PDB entry)
  8. 2787515Domain d6gwkf_: 6gwk F: [369120]
    automated match to d3inzf_

Details for d6gwkf_

PDB Entry: 6gwk (more details), 2.15 Å

PDB Description: the crystal structure of hfq from caulobacter crescentus
PDB Compounds: (F:) RNA-binding protein Hfq

SCOPe Domain Sequences for d6gwkf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6gwkf_ b.38.1.0 (F:) automated matches {Caulobacter vibrioides [TaxId: 190650]}
qnlqdtflnsvrksktpltiflvngvklqgvvswfdnfcvllrrdgqsqlvykhaistim
paqpvqly

SCOPe Domain Coordinates for d6gwkf_:

Click to download the PDB-style file with coordinates for d6gwkf_.
(The format of our PDB-style files is described here.)

Timeline for d6gwkf_: