Lineage for d6hbga_ (6hbg A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2821496Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2821778Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) (S)
  5. 2821779Family b.121.4.1: Picornaviridae-like VP (VP1, VP2, VP3 and VP4) [88634] (10 proteins)
    the order of the chains N-VP0-VP3-VP1-C is as in the polyprotein; VP0 is cleaved later upon capsid assembly to VP4 and VP2
    there is a different order in the shuffled genome of insect picorna-like proteins (Cricket paralysis virus)
  6. 2822070Protein automated matches [190854] (26 species)
    not a true protein
  7. 2822125Species Echovirus e18 [TaxId:47506] [366473] (2 PDB entries)
  8. 2822126Domain d6hbga_: 6hbg A: [369097]
    automated match to d1upna_
    complexed with gun, plm

Details for d6hbga_

PDB Entry: 6hbg (more details), 3.16 Å

PDB Description: echovirus 18 native particle
PDB Compounds: (A:) Echovirus 18 viral protein 1

SCOPe Domain Sequences for d6hbga_:

Sequence, based on SEQRES records: (download)

>d6hbga_ b.121.4.1 (A:) automated matches {Echovirus e18 [TaxId: 47506]}
tvantqpsgpsnsteipaltavetghtsqvdpsdtiqtrhvvnfhsrsestienfmgraa
cvfmdqykingeetstdrfavwtiniremaqlrrkcemftymrfdiemtmvitscqdqgt
ildqdmpvlthqimyvppggpipakvdgyewqtstnpsvfwtegnapprisipfisvgna
yssfydgwshftqdgtygyttlnamgklyirhvnrssphqitstirvyfkpkhikawvpr
pprlcpyinkrdvnfvvteitdsrtsitdtp

Sequence, based on observed residues (ATOM records): (download)

>d6hbga_ b.121.4.1 (A:) automated matches {Echovirus e18 [TaxId: 47506]}
tvantqpsgpsnsteipaltavetghtsqvdpsdtiqtrhvvnfhsrsestienfmgraa
cvfmdqykinstdrfavwtiniremaqlrrkcemftymrfdiemtmvitscqdqdmpvlt
hqimyvppggpipakvdgyewqtstnpsvfwtegnapprisipfisvgnayssfydgwsh
ftqdgtygyttlnamgklyirhvnrssphqitstirvyfkpkhikawvprpprlcpyink
rdvnfvvteitdsrtsitdtp

SCOPe Domain Coordinates for d6hbga_:

Click to download the PDB-style file with coordinates for d6hbga_.
(The format of our PDB-style files is described here.)

Timeline for d6hbga_: