![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.22: GFP-like [54510] (1 superfamily) beta-sheet folds into a barrel (n=11, S=14) around the central helix |
![]() | Superfamily d.22.1: GFP-like [54511] (3 families) ![]() |
![]() | Family d.22.1.0: automated matches [191400] (1 protein) not a true family |
![]() | Protein automated matches [190526] (26 species) not a true protein |
![]() | Species Lobophyllia hemprichii [TaxId:46758] [187486] (25 PDB entries) |
![]() | Domain d6gp0a1: 6gp0 A:1-219 [369095] Other proteins in same PDB: d6gp0a2 automated match to d2dddb_ complexed with iey |
PDB Entry: 6gp0 (more details), 1.5 Å
SCOPe Domain Sequences for d6gp0a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6gp0a1 d.22.1.0 (A:1-219) automated matches {Lobophyllia hemprichii [TaxId: 46758]} msaikpdmriklrmegnvnghhfvidgdgtgkpyegkqtmdlevkeggplpfafdiltta fxhygnrvfvkypdniqdyfkqsfpkgyswersltfedggicnarnditmegdtfynkvr fygtnfpangpvmqkktlkwepstekmyvrdgvltgdiemalllegnahyrcdfrttyka kekgvklpgahfvdhaieilshdkdynkvklyehavahsg
Timeline for d6gp0a1: