SCOPe 2.08: Domain d6gp0a1: 6gp0 A:1-219

Lineage for d6gp0a1 (6gp0 A:1-219)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.22: GFP-like [54510] (1 superfamily)
   beta-sheet folds into a barrel (n=11, S=14) around the central helix

4. Superfamily d.22.1: GFP-like [54511] (3 families)

5. Family d.22.1.0: automated matches [191400] (1 protein)
   not a true family

6. Protein automated matches [190526] (26 species)
   not a true protein

7. Species Lobophyllia hemprichii [TaxId:46758] [187486] (25 PDB entries)

8. Domain d6gp0a1: 6gp0 A:1-219 [369095]
   Other proteins in same PDB: d6gp0a2
   automated match to d2dddb_
   complexed with iey

Details for d6gp0a1

PDB Entry: 6gp0, 1.5 Å

PDB Description: structure of meos4b in the red fluorescent state

PDB Compounds: (A:) Green to red photoconvertible GFP-like protein EosFP

SCOPe Domain Sequences for d6gp0a1:

Sequence; same for both SEQRES and ATOM records:

>d6gp0a1 d.22.1.0 (A:1-219) automated matches {Lobophyllia hemprichii [TaxId: 46758]}
msaikpdmriklrmegnvnghhfvidgdgtgkpyegkqtmdlevkeggplpfafdiltta
fxhygnrvfvkypdniqdyfkqsfpkgyswersltfedggicnarnditmegdtfynkvr
fygtnfpangpvmqkktlkwepstekmyvrdgvltgdiemalllegnahyrcdfrttyka
kekgvklpgahfvdhaieilshdkdynkvklyehavahsg

Timeline for d6gp0a1:

• d6gp0a1 first appeared in SCOPe 2.07