Class b: All beta proteins [48724] (178 folds) |
Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
Superfamily b.19.1: Viral protein domain [49818] (4 families) forms homotrimers |
Family b.19.1.0: automated matches [227246] (1 protein) not a true family |
Protein automated matches [227017] (57 species) not a true protein |
Species Influenza a virus [TaxId:387139] [369088] (2 PDB entries) |
Domain d6e56a_: 6e56 A: [369090] Other proteins in same PDB: d6e56i1, d6e56i2, d6e56j1, d6e56j2 automated match to d3s13a_ complexed with act, nag |
PDB Entry: 6e56 (more details), 2 Å
SCOPe Domain Sequences for d6e56a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6e56a_ b.19.1.0 (A:) automated matches {Influenza a virus [TaxId: 387139]} telvqssstgkicnnphrildgidctlidallgdphcdvfqnetwdlfverskafsncyp ydvpdyaslrslvassgtlefitegftwtgvtqnggsnackrgpgsgffsrlnwltksgs typvlnvtmpnndnfdklyiwgihhpstdqeqtslyvqasgrvtvstrrsqqtiipnigs rpwvrglssrisiywtivkpgdvlvinsngnliaprgyfkmrtgkssimrsdapidtcis ecitpngsipndkpfqnvnkitygacpkyvkq
Timeline for d6e56a_: