Lineage for d6ggba_ (6ggb A:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. Superfamily b.2.5: p53-like transcription factors [49417] (8 families) (S)
  5. Family b.2.5.2: p53 DNA-binding domain-like [81314] (3 proteins)
  6. Protein p53 tumor suppressor, DNA-binding domain [49419] (2 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [49420] (65 PDB entries)
  8. Domain d6ggba_: 6ggb A: [369065]
    automated match to d2feja_
    protein/DNA complex; complexed with edo, epe, exq, gol, zn; mutant

Details for d6ggba_

PDB Entry: 6ggb (more details), 1.32 Å

PDB Description: p53 cancer mutant y220c in complex with small-molecule stabilizer pk9318
PDB Compounds: (A:) Cellular tumor antigen p53

SCOPe Domain Sequences for d6ggba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ggba_ b.2.5.2 (A:) p53 tumor suppressor, DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]}
ssvpsqktyqgsygfrlgflhsgtaksvtctyspalnklfcqlaktcpvqlwvdstpppg
trvramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlraeylddrntfrh
svvvpceppevgsdcttihynymcysscmggmnrrpiltiitledssgnllgrdsfevrv
cacpgrdrrteeenlrkk

SCOPe Domain Coordinates for d6ggba_ are not available.

Timeline for d6ggba_:

Domains from other chains:
(mouse over for more information)
d6ggbb_